Antibodies

View as table Download

RERG rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

RERG rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-RERG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RERG antibody: synthetic peptide directed towards the C terminal of human RERG. Synthetic peptide located within the following region: CAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAIN

Rerg Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated