RBP4 mouse monoclonal antibody, clone 4C2, Ascites
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
RBP4 mouse monoclonal antibody, clone 4C2, Ascites
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
RBP4 mouse monoclonal antibody, clone AT2B4, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
RBP4 mouse monoclonal antibody, clone AT2B4, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RBP4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RBP4 |
Rabbit anti-RBP4 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of human RBP4 |
Goat Polyclonal Antibody against RBP4
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QKGNDDHWIVDTDYD, from the internal region of the protein sequence according to NP_006735.2. |
Goat Polyclonal Antibody against RBP4 (Internal)
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DTEDPAKFKMKY, from the internal region of the protein sequence according to NP_006735.2. |
Rabbit Polyclonal Anti-RBP4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RBP4 antibody: synthetic peptide directed towards the N terminal of human RBP4. Synthetic peptide located within the following region: MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP |
RBP4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-201 of human RBP4 (NP_006735.2). |
Modifications | Unmodified |
RBP4 mouse monoclonal antibody, clone RB42
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
RBP4 mouse monoclonal antibody, clone RB45
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
RBP4 mouse monoclonal antibody, clone RB48
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
RBP4 mouse monoclonal antibody, clone RB55
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
RBP4 (169-183) rabbit polyclonal antibody, Serum
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic Human RBP4 (aa 169-183) KLH-conjugated (VHNGYCDGRSERNLL) |
RBP4 (169-183) rabbit polyclonal antibody, Serum
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic Human RBP4 (aa 169-183) KLH-conjugated (VHNGYCDGRSERNLL) |