Rabbit polyclonal Anti-RASGRF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RASGRF1 antibody: synthetic peptide directed towards the N terminal of human RASGRF1. Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG |
Rabbit polyclonal Anti-RASGRF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RASGRF1 antibody: synthetic peptide directed towards the middle region of human RASGRF1. Synthetic peptide located within the following region: PMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNG |
Rabbit polyclonal anti-Ras-GRF1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Ras-GRF1. |
Rabbit polyclonal Ras-GRF1 (Ser916) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Ras-GRF1 around the phosphorylation site of serine 916 (R-M-SP-L-A). |
| Modifications | Phospho-specific |
RASGRF1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide corresponding to amino acid residues surrounding S929 of human RASGRF1. |
Rasgrf1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
RASGRF1 pSer916 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of Serine 916(N-E-G(p)-T P) derived from Human Ras-GRF1 (KLH-conjugated) |
RASGRF1 pSer916 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of Serine 916(N-E-G(p)-T P) derived from Human Ras-GRF1 (KLH-conjugated) |
RASGRF1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human RASGRF1 |
RASGRF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human RASGRF1 (NP_001139120.1). |
| Modifications | Unmodified |
CDC25 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
