Germany
Japan
United Kingdom
China
RANBP3 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Immunized with a KLH conjugated synthetic peptide between 26-55 amino acids from the N-terminal region of human RANBP3 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RANBP3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RANBP3 antibody: synthetic peptide directed towards the N terminal of human RANBP3. Synthetic peptide located within the following region: MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH |
RANBP3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human RANBP3 |
RANBP3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human RANBP3 (NP_015559.2). |
| Modifications | Unmodified |
RANBP3 mouse monoclonal antibody, clone AT12E11, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
RANBP3 mouse monoclonal antibody, clone AT12E11, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RANBP3