Rabbit Polyclonal Anti-R3hdm4 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-R3hdm4 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse R3hdm4. Synthetic peptide located within the following region: MVALDNSEGGPEATPSGETRLSLPGCLPPLSGSQVKRVSASRRKQHFINQ |
Rabbit Polyclonal Anti-R3HDM4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-R3HDM4 Antibody is: synthetic peptide directed towards the N-terminal region of Human R3HDM4. Synthetic peptide located within the following region: RRKQHFINQAVRNSDLVPKAKGRKSLQRLENTQYLLTLLETDGGLPGLED |
Germany
Japan
United Kingdom
China