Rabbit Polyclonal Anti-PRSS55 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PRSS55 Antibody is: synthetic peptide directed towards the C-terminal region of Human PRSS55. Synthetic peptide located within the following region: SKMFPKLTKNMLCAGYKNESYDACKGDSGGPLVCTPEPGEKWYQVGIISW |
PRSS55 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 296-326 amino acids from the C-terminal region of human UNQ9391 |
Rabbit Polyclonal Anti-PRSS55 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PRSS55 Antibody is: synthetic peptide directed towards the C-terminal region of Human PRSS55. Synthetic peptide located within the following region: SWGKSCGEKNTPGIYTSLVNYNLWIEKVTQLEGRPFNAEKRRTSVKQKPM |
Germany
Japan
United Kingdom
China