Antibodies

Jump to Filters
View as table Download
PREPL Rabbit Polyclonal Antibody
TA370788

USD 380.00

4 Weeks

PREPL rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PREPL
PREPL Rabbit Polyclonal Antibody
TA366443

USD 380.00

4 Weeks

PREPL rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PREPL
PREPL Rabbit Polyclonal Antibody
TA380313

USD 365.00

3 Weeks

PREPL Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 578-727 of human PREPL (NP_006027.2).
Modifications Unmodified
Prepl Rabbit Polyclonal Antibody
TA337893

USD 539.00

5 Days

Rabbit Polyclonal Anti-Prepl Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Prepl antibody is: synthetic peptide directed towards the C-terminal region of Mouse Prepl. Synthetic peptide located within the following region: LRAVTLEAPFLDVLNTMLDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCP