Rabbit Polyclonal Anti-POP5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POP5 antibody: synthetic peptide directed towards the middle region of human POP5. Synthetic peptide located within the following region: IRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQKSVTRSCLLEEEEESGE |
Rabbit Polyclonal Anti-POP5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POP5 antibody: synthetic peptide directed towards the middle region of human POP5. Synthetic peptide located within the following region: KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRR |
POP5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human POP5 (NP_057002.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China