POLA2 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
POLA2 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
POLA2 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
POLA2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLA2 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLA2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLA2 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
POLA2 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
POLA2 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
POLA2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
POLA2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
POLA2 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
POLA2 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-POLA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLA2 antibody is: synthetic peptide directed towards the N-terminal region of Human POLA2. Synthetic peptide located within the following region: VGLTSEILNSFEHEFLSKRLSKARHSTCKDSGHAGARDIVSIQELIEVEE |
Rabbit Polyclonal Anti-Pola2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pola2 antibody is: synthetic peptide directed towards the middle region of MOUSE Pola2. Synthetic peptide located within the following region: FSPSATPSQKYTSRTNRGEVVTTFGSAQGLSWSGRGGSGSVSLKVVGDPE |
POLA2 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |