Rabbit Polyclonal PHOX2A Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PHOX2A antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of human PHOX2A. |
Rabbit Polyclonal PHOX2A Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PHOX2A antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of human PHOX2A. |
Goat Anti-PHOX2A (aa165-179) Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KGEARCSSEDDDSKE, from the internal region of the protein sequence according to NP_005160.2. |
Rabbit Polyclonal anti-PHOX2A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PHOX2A antibody: synthetic peptide directed towards the N terminal of human PHOX2A. Synthetic peptide located within the following region: AVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTRE |
Rabbit Polyclonal Anti-PHOX2A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PHOX2A antibody: synthetic peptide directed towards the N terminal of human PHOX2A. Synthetic peptide located within the following region: SAVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTR |
Rabbit Polyclonal Anti-PHOX2A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PHOX2A antibody: synthetic peptide directed towards the C terminal of human PHOX2A. Synthetic peptide located within the following region: VAGGGGGGPGAGAAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF |