Antibodies

View as table Download

Rabbit Polyclonal PHOX2A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PHOX2A antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of human PHOX2A.

Goat Anti-PHOX2A (aa165-179) Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence KGEARCSSEDDDSKE, from the internal region of the protein sequence according to NP_005160.2.

Rabbit Polyclonal anti-PHOX2A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHOX2A antibody: synthetic peptide directed towards the N terminal of human PHOX2A. Synthetic peptide located within the following region: AVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTRE

Rabbit Polyclonal Anti-PHOX2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHOX2A antibody: synthetic peptide directed towards the N terminal of human PHOX2A. Synthetic peptide located within the following region: SAVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTR

Rabbit Polyclonal Anti-PHOX2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHOX2A antibody: synthetic peptide directed towards the C terminal of human PHOX2A. Synthetic peptide located within the following region: VAGGGGGGPGAGAAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF