Antibodies

View as table Download

Rabbit Polyclonal Anti-PHF13

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHF13 antibody: synthetic peptide directed towards the middle region of human PHF13. Synthetic peptide located within the following region: GSCATVSPDQVKEIKTEGKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDD

Rabbit Polyclonal Anti-PHF13

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHF13 antibody: synthetic peptide directed towards the N terminal of human PHF13. Synthetic peptide located within the following region: LAYAGYIPYPKEELPLRSSPSPANSTAGTIDSDGWDAGFSDIASSVPLPV