PGD mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PGD mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PGD mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PGD mouse monoclonal antibody,clone 2A5, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PGD mouse monoclonal antibody,clone 2A5, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PGD mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PGD Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 184-483 of human PGD (NP_002622.2). |
Modifications | Unmodified |
Rabbit Polyclonal antibody to PGD (phosphogluconate dehydrogenase)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Chicken, Xenopus, Zebrafish, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 201 of PGD (Uniprot ID#P52209) |
Rabbit polyclonal anti-PGD antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PGD. |
Rabbit Polyclonal Anti-PGD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PGD antibody is: synthetic peptide directed towards the N-terminal region of PGD. Synthetic peptide located within the following region: DFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGE |