Antibodies

Jump to Filters
View as table Download
PEX7 Rabbit Polyclonal Antibody
TA314328

USD 380.00

In Stock

Rabbit polyclonal anti-PEX7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PEX7.
PEX7 Rabbit Polyclonal Antibody
AP32319PU-N

USD 535.00

2 Weeks

PEX7 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from internal region of human Peroxin 7 / PEX7
PEX7 Mouse Monoclonal Antibody [Clone ID: N232/9]
75-256

USD 640.00

3 Weeks

PEX7 mouse monoclonal antibody, clone N232/9

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PEX7 Rabbit Polyclonal Antibody
TA335139

USD 539.00

5 Days

Rabbit polyclonal Anti-PEX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PEX7 antibody: synthetic peptide directed towards the N terminal of human PEX7. Synthetic peptide located within the following region: MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI