Rabbit Polyclonal Anti-PRDX2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PRDX2 |
Rabbit Polyclonal Anti-PRDX2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PRDX2 |
Rabbit Polyclonal Peroxiredoxin 2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the Middle Region |
Rabbit polyclonal PRDX2 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat, Bovine, Hamster, Monkey) |
Conjugation | Unconjugated |
Immunogen | This PRDX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 169-198 amino acids from the C-terminal region of human PRDX2. |
Rabbit Polyclonal Anti-PRDX2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDX2 antibody: synthetic peptide directed towards the middle region of human PRDX2. Synthetic peptide located within the following region: VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTD |
PRDX2 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRDX2 |
Goat Polyclonal Antibody against PRDX2
Applications | WB |
Reactivities | Human, Mouse (Expected from sequence similarity: Rat) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NVDDSKEYFSKHN, from the C Terminus of the protein sequence according to NP_005800.3; NP_859427.1. |