Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal PRDX2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine, Hamster, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This PRDX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 169-198 amino acids from the C-terminal region of human PRDX2. |
Rabbit Polyclonal Anti-PRDX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX2 antibody: synthetic peptide directed towards the middle region of human PRDX2. Synthetic peptide located within the following region: VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTD |
Goat Polyclonal Antibody against PRDX2
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NVDDSKEYFSKHN, from the C Terminus of the protein sequence according to NP_005800.3; NP_859427.1. |
Active filters
Target Symbol
- PEROXIREDOXIN 2