PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PCBP1 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PCBP1 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PCBP1 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PCBP1 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PCBP1 mouse monoclonal antibody, clone OTI10B7 (formerly 10B7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PCBP1 mouse monoclonal antibody, clone OTI10B7 (formerly 10B7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PCBP1 mouse monoclonal antibody, clone OTI10B7 (formerly 10B7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PCBP1 mouse monoclonal antibody, clone OTI10B7 (formerly 10B7), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-PCBP1 Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PCBP1 antibody is: synthetic peptide directed towards the middle region of Human PCBP1. Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF |
PCBP1 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |