Antibodies

View as table Download

Rabbit Polyclonal Anti-DLG2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DLG2

Rabbit Polyclonal Anti-DLG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DLG2 Antibody: synthetic peptide directed towards the N terminal of human DLG2. Synthetic peptide located within the following region: MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS