Antibodies

Jump to Filters
View as table Download
PNLIPRP3 (N-term) Rabbit Polyclonal Antibody
AP53367PU-N

USD 580.00

2 Weeks

PNLIPRP3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 70-100 amino acids from the N-terminal region of human PNLIPRP3
PNLIPRP3 Rabbit Polyclonal Antibody
TA334144

USD 539.00

5 Days

Rabbit Polyclonal Anti-PNLIPRP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PNLIPRP3 Antibody is: synthetic peptide directed towards the C-terminal region of Human PNLIPRP3. Synthetic peptide located within the following region: IVSGKLEPGMTYTKLIDADVNVGNITSVQFIWKKHLFEDSQNKLGAEMVI