Antibodies

Jump to Filters
View as table Download
PLEKHH2 (C-term) Rabbit Polyclonal Antibody
AP53317PU-N

USD 580.00

2 Weeks

PLEKHH2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1057~1086 amino acids from the C-terminal region of human PLEKHH2
PLEKHH2 Rabbit Polyclonal Antibody
TA337802

USD 539.00

5 Days

Rabbit Polyclonal Anti-PLEKHH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLEKHH2 antibody: synthetic peptide directed towards the C terminal of human PLEKHH2. Synthetic peptide located within the following region: WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAIYCQRCVERTQ