Antibodies

View as table Download

Rabbit Polyclonal Anti-PGAP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGAP3 antibody: synthetic peptide directed towards the N terminal of human PGAP3. Synthetic peptide located within the following region: AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS

Rabbit Polyclonal Anti-PGAP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGAP3 antibody: synthetic peptide directed towards the N terminal of human PGAP3. Synthetic peptide located within the following region: ECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLV