PFDN6 (PFD6) mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PFDN6 (PFD6) mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PFDN6 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PFDN6 (PFD6) mouse monoclonal antibody, clone OTI4E10 (formerly 4E10), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
PFDN6 (PFD6) mouse monoclonal antibody, clone OTI4E10 (formerly 4E10), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-PFDN6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PFDN6 |
PFDN6 (PFD6) mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PFDN6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PFDN6 antibody: synthetic peptide directed towards the N terminal of human PFDN6. Synthetic peptide located within the following region: MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL |