Antibodies

View as table Download

Rabbit Polyclonal antibody to PEX26 (peroxisomal biogenesis factor 26)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 305 of PEX26 (Uniprot ID#Q7Z412)

Goat Anti-PEX26 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKPNLEGSVSHK, from the internal region of the protein sequence according to NP_060399.1.

Rabbit Polyclonal Anti-PEX26 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PEX26 antibody: synthetic peptide directed towards the middle region of human PEX26. Synthetic peptide located within the following region: ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK

Rabbit Polyclonal Anti-PEX26 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PEX26 antibody: synthetic peptide directed towards the N terminal of human PEX26. Synthetic peptide located within the following region: MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLD

PEX26 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PEX26