Germany
Japan
United Kingdom
China
Antibodies
View as table Download
PDLIM1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 253-282 amino acids from the C-terminal region of Human PDLIM1 |
Goat Polyclonal Antibody against PDLIM1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TPPEGYEVVTVFPK, from the C Terminus of the protein sequence according to NP_066272. |
Rabbit Polyclonal Anti-PDLIM1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDLIM1 antibody: synthetic peptide directed towards the middle region of mouse PDLIM1. Synthetic peptide located within the following region: TSASGEEANSRPVVQPHPSGSLIIDKDSEVYKMLQEKQELNEPPKQSTSF |
Rabbit Polyclonal Anti-CLIM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIM1 Antibody: A synthesized peptide derived from human CLIM1 |
PDLIM1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse PDLIM1_x000D_ |
PDLIM1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PDLIM1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PDLIM1 |
Active filters
Target Symbol
- PDLIM1