Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
PATZ1 mouse monoclonal antibody,clone OTI2H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PATZ1 mouse monoclonal antibody,clone OTI8D6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PATZ1 mouse monoclonal antibody,clone OTI2H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PATZ1 mouse monoclonal antibody,clone OTI8D6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
PATZ1 mouse monoclonal antibody,clone OTI2H4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PATZ1 mouse monoclonal antibody,clone OTI2H4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 509.00
2 Weeks
PATZ1 mouse monoclonal antibody,clone OTI8D6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PATZ1 mouse monoclonal antibody,clone OTI8D6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Rabbit Polyclonal Anti-PATZ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PATZ1 antibody: synthetic peptide directed towards the N terminal of human PATZ1. Synthetic peptide located within the following region: KNGGRFCDVLLRVGDESFPAHRAVLAACSEYFESVFSAQLGDGGAADGGP |
Rabbit Polyclonal Anti-PATZ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PATZ1 antibody: synthetic peptide directed towards the N terminal of human PATZ1. Synthetic peptide located within the following region: MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDE |
Active filters
Target Symbol
- PATZ1