PARS2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PARS2 |
PARS2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PARS2 |
PARS2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PARS2 |
Rabbit Polyclonal Anti-PARS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PARS2 antibody is: synthetic peptide directed towards the C-terminal region of Human PARS2. Synthetic peptide located within the following region: AIEVLSTEDCVRWPSLLAPYQACLIPPKKGSKEQAASELIGQLYDHITEA |
Rabbit Polyclonal Anti-PARS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PARS2 antibody is: synthetic peptide directed towards the N-terminal region of Human PARS2. Synthetic peptide located within the following region: GGQKVNMPSLSPAELWQATNRWDLMGKELLRLRDRHGKEYCLGPTHEEAI |
PARS2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-220 of human PARS2 (NP_689481.2). |
Modifications | Unmodified |
PARS2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-220 of human PARS2 (NP_689481.2). |
Modifications | Unmodified |