Antibodies

Jump to Filters
View as table Download
PADI6 Rabbit Polyclonal Antibody
TA337699

USD 539.00

5 Days

Rabbit Polyclonal Anti-PADI6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PADI6 antibody is: synthetic peptide directed towards the N-terminal region of Human PADI6. Synthetic peptide located within the following region: GAILLVNCNPADVGQQLEDKKTKKVIFSEEITNLSQMTLNVQGPSCILKK
PADI6 Rabbit Polyclonal Antibody
TA362796

USD 539.00

5 Days

PADI6 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PADI6