Germany
Japan
United Kingdom
China
P4HA3 mouse monoclonal antibody,clone OTI9A2
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Carrier-free (BSA/glycerol-free) P4HA3 mouse monoclonal antibody,clone OTI9A2
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
P4HA3 mouse monoclonal antibody,clone OTI9A2, Biotinylated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
P4HA3 mouse monoclonal antibody,clone OTI9A2, HRP conjugated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Rabbit Polyclonal Anti-P4HA3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P4HA3 antibody is: synthetic peptide directed towards the N-terminal region of Human P4HA3. Synthetic peptide located within the following region: EDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQD |
P4HA3 mouse monoclonal antibody,clone OTI9A2
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- P4HA3