Rabbit Polyclonal Anti-OTP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OTP antibody: synthetic peptide directed towards the N terminal of human OTP. Synthetic peptide located within the following region: SDPGGHPGDLAPNSDPVEGATLLPGEDITTVGSTPASLAVSAKDPDKQPG |
OTP Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human OTP (NP_115485.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-OTP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OTP antibody: synthetic peptide directed towards the N terminal of human OTP. Synthetic peptide located within the following region: MLSHADLLDARLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDLAPNSD |
Rabbit Polyclonal Anti-OTP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OTP antibody: synthetic peptide directed towards the C terminal of human OTP. Synthetic peptide located within the following region: PAFPGMVPASLPGPSNVSGSPQLCSSPDSSDVWRGTSIASLRRKALEHTV |
Germany
Japan
United Kingdom
China