Antibodies

Jump to Filters
View as table Download
Olfactory receptor 10X1 (OR10X1) Rabbit Polyclonal Antibody
TA316090

USD 380.00

In Stock

Rabbit polyclonal anti-OR10X1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10X1.
Olfactory receptor 10X1 (OR10X1) (Center) Rabbit Polyclonal Antibody
AP53014PU-N

USD 580.00

2 Weeks

Olfactory receptor 10X1 (OR10X1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 88-118 amino acids from the Center region of Human Olfactory receptor 10X1
Olfactory receptor 10X1 (OR10X1) Rabbit Polyclonal Antibody
TA344311

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR10X1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR10X1 antibody: synthetic peptide directed towards the middle region of human OR10X1. Synthetic peptide located within the following region: NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP