Antibodies

Jump to Filters
View as table Download
OCIAD1 Rabbit Polyclonal Antibody
TA306866

USD 570.00

5 Days

Rabbit Polyclonal OCIAD1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen OCIAD1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human OCIAD1.
OCIAD1 Rabbit Polyclonal Antibody
TA379439

USD 365.00

3 Weeks

OCIAD1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human OCIAD1 (NP_060300.1).
Modifications Unmodified
OCIAD1 Rabbit Polyclonal Antibody
TA350248

USD 380.00

In Stock

Rabbit Polyclonal Anti-OCIAD1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human OCIAD1
OCIAD1 Rabbit Polyclonal Antibody
TA346628

USD 539.00

5 Days

Rabbit Polyclonal Anti-OCIAD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OCIAD1 antibody: synthetic peptide directed towards the C terminal of human OCIAD1. Synthetic peptide located within the following region: QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK
OCIAD1 Rabbit Polyclonal Antibody
TA369250

USD 380.00

4 Weeks

OCIAD1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human OCIAD1