OSBP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
OSBP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) OSBP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
OSBP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
OSBP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
OSBP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
OSBP mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) OSBP mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
OSBP mouse monoclonal antibody, clone OTI1A4 (formerly 1A4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
OSBP mouse monoclonal antibody, clone OTI1A4 (formerly 1A4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
OSBP mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-OSBP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OSBP antibody: synthetic peptide directed towards the C terminal of human OSBP. Synthetic peptide located within the following region: ALTLNAWESGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKK |
Goat Polyclonal Antibody against OSBP
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KHQLEETKKEKRTRIP, from the internal region of the protein sequence according to NP_002547. |
Goat Anti-OSBP1 (C Terminus) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CKEKQDWSSCPDIF, from the C Terminus of the protein sequence according to NP_002547.1. |
OSBP Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human OSBP |