Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Carrier-free (BSA/glycerol-free) OSBP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
USD 509.00
2 Weeks
USD 509.00
2 Weeks
USD 509.00
2 Weeks
Rabbit Polyclonal Anti-OSBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OSBP antibody: synthetic peptide directed towards the C terminal of human OSBP. Synthetic peptide located within the following region: ALTLNAWESGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKK |
Goat Polyclonal Antibody against OSBP
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KHQLEETKKEKRTRIP, from the internal region of the protein sequence according to NP_002547. |
Goat Anti-OSBP1 (C Terminus) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CKEKQDWSSCPDIF, from the C Terminus of the protein sequence according to NP_002547.1. |
OSBP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human OSBP |
Active filters
Target Symbol
- OSBP1