Germany
Japan
United Kingdom
China
OR6N2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 251-281 amino acids from the C-terminal region of human Olfactory receptor 6N2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-OR6N2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR6N2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6N2. Synthetic peptide located within the following region: KSYSLTLDRTLAIVYSVLTPMVNPIIYSLRNKEIIKAIKRTIFQKGDKAS |
Active filters
Target Symbol
- OR6N2