Antibodies

View as table Download

Anti-NPPC Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 111-125 amino acids of Human notch 4

Rabbit Polyclonal Anti-NPPC Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Nppc antibody is: synthetic peptide directed towards the C-terminal region of Nppc. Synthetic peptide located within the following region: LLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS

Rabbit polyclonal anti C-Type Natriuretic Peptide (1-29) (ms, po, rat); neat antiserum

Applications ELISA
Reactivities Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp- Ala-Arg-Leu-Leu-His-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Gly-Asn- OH coupled to a carrier protein.

Rabbit polyclonal anti C-Type Natriuretic Peptide (1-29) (ms, po, rt); purified rabbit IgG

Applications ELISA
Reactivities Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp- Ala-Arg-Leu-Leu-His-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Gly-Asn- OH coupled to a carrier protein.

Rabbit polyclonal anti human / porcine / rat C-Type Natriuretic Peptide (CNP) (32-53)

Applications ELISA
Reactivities Human, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu- Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH (disulfide bond) coupled to carrier protein.

Rabbit polyclonal anti C-Type Natriuretic Peptide (32-53) (hu, po, rt); neat antiserum

Applications ELISA
Reactivities Human, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu- Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH, (Disulfide bond) coupled to carrier protein.

NPPC (proCNP 1-19) sheep polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic human pro-CNP (aa 1-19)

NPPC (proCNP 1-19) sheep polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic human pro-CNP (aa 1-19)

NPPC (proCNP 30-50) sheep polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic Human pro-CNP (aa 30-50)

NPPC (proCNP 30-50) sheep polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic Human pro-CNP (aa 30-50)

NPPC (proCNP 51-80) sheep polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic Human pro-CNP (aa 51-79)

NPPC (proCNP 51-80) sheep polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic Human pro-CNP (aa 51-79)

Rabbit polyclonal anti C-Type Natriuretic Peptide (32-53) (hu, po, rt); diluted antiserum

Applications ELISA
Reactivities Human, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu- Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH, (Disulfide bond) coupled to carrier protein.