Rabbit Polyclonal Anti-NPFFR2 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | NPFF2 / NPFFR2 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human NPFFR2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (94%); Marmoset (89%). |
Rabbit Polyclonal Anti-NPFFR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPFFR2 antibody: synthetic peptide directed towards the C terminal of human NPFFR2. Synthetic peptide located within the following region: KAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT |
Rabbit Polyclonal Anti-NPFFR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPFFR2 antibody: synthetic peptide directed towards the middle region of human NPFFR2. Synthetic peptide located within the following region: VPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYA |
NPFFR2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human NPFFR2 (NP_004876.2). |
| Modifications | Unmodified |
NPFFR2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
