Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-NLE1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NLE1. |
Antibodies
View as table Download
NLE1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Nle1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nle1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Nle1. Synthetic peptide located within the following region: FTLFLWSPAEDKKPLARMTGHQALINQVLFSPDSRIVASASFDKSIKLWD |
Rabbit Polyclonal Anti-NLE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NLE1 antibody is: synthetic peptide directed towards the C-terminal region of Human NLE1. Synthetic peptide located within the following region: DSTLKVWDVKAQKLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIWR |
Active filters
Target Symbol
- NLE1