Antibodies

Jump to Filters
View as table Download
Neo1 Rabbit Polyclonal Antibody
TA341799

USD 539.00

5 Days

Rabbit Polyclonal Anti-Neo1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Neo1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Neo1. Synthetic peptide located within the following region: PPPPLLLLLPLLLLLGRPASGAAATKSGSPPQSAGASVRTFTPFYFLVEP