Rabbit Polyclonal Anti-NAT9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NAT9 antibody: synthetic peptide directed towards the N terminal of human NAT9. Synthetic peptide located within the following region: MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ |
Rabbit Polyclonal Anti-NAT9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NAT9 antibody is: synthetic peptide directed towards the C-terminal region of Human NAT9. Synthetic peptide located within the following region: KLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC |
Germany
Japan
United Kingdom
China