Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NUP50 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUP50 antibody: synthetic peptide directed towards the C terminal of human NUP50. Synthetic peptide located within the following region: TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED |
NUP50 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 299-468 of human NUP50 (NP_009103.2). |
| Modifications | Unmodified |
NUP50 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 223-252 amino acids from the Central region of human NUP50. |
Goat Polyclonal Antibody against NUP50
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ELHKILLEKKDA, from the C Terminus of the protein sequence according to NP_009103; NP_705931; NP_710151. |
Rabbit Polyclonal Anti-Npap60 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Npap60 antibody is: synthetic peptide directed towards the N-terminal region of Rat Npap60. Synthetic peptide located within the following region: VEEMGTFSVASEEVMKNRAVKKAKRRNIGFESDSGGAFKGFKGLVVPSGG |
Active filters
Target Symbol
- NUP50