Rabbit Polyclonal Anti-NT5DC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NT5DC3 antibody is: synthetic peptide directed towards the C-terminal region of Human NT5DC3. Synthetic peptide located within the following region: GLLEQMQVHRDAESQLVLQEWKKERKEMREMTKSFFNAQFGSLFRTDQNP |
Rabbit Polyclonal Anti-NT5DC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NT5DC3 antibody is: synthetic peptide directed towards the N-terminal region of Human NT5DC3. Synthetic peptide located within the following region: AARGRPCAGPARPLCTAPGTAPDMKRYLWERYREAKRSTEELVPSIMSNL |
NT5DC3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from human NT5DC3 |
Germany
Japan
United Kingdom
China