NSUN2 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 508-767 of human NSUN2 (NP_060225.4). |
| Modifications | Unmodified |
NSUN2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 426-455 amino acids from the Central region of human NSUN2 |
Rabbit Polyclonal Anti-NSUN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NSUN2 antibody: synthetic peptide directed towards the C terminal of human NSUN2. Synthetic peptide located within the following region: FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP |
NSUN2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human NSUN2 |
Nsun2 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from internal domain of mouse Nsun2 protein |
Germany
Japan
United Kingdom
China
