Rabbit Polyclonal Anti-NSMCE4A Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NSMCE4A antibody is: synthetic peptide directed towards the C-terminal region of Human NSMCE4A. Synthetic peptide located within the following region: PVIQEERAMPAQLRRMEESHQEATEKEVERILGLLQTYFREDPDTPMSFF |
NSMCE4A (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 36~65 amino acids from the N-terminal region of human NSE4A |
Rabbit Polyclonal Anti-NSMCE4A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NSMCE4A antibody is: synthetic peptide directed towards the C-terminal region of Human NSMCE4A. Synthetic peptide located within the following region: NEENEGFEHNTQVRNQGIIALSYRDWEIVKTFEISEPVITPSQRQQKPSA |
Germany
Japan
United Kingdom
China
