Antibodies

Jump to Filters
View as table Download
NRIP3 Mouse Monoclonal Antibody [Clone ID: OTI1A9]
TA504936

USD 447.00

In Stock

NRIP3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NRIP3 Mouse Monoclonal Antibody [Clone ID: OTI1A9]
CF504936

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) NRIP3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NRIP3 Mouse Monoclonal Antibody [Clone ID: OTI1G6]
TA504921

USD 224.00

USD 447.00

In Stock

NRIP3 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NRIP3 Mouse Monoclonal Antibody [Clone ID: OTI1G6]
CF504921

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) NRIP3 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NRIP3 Mouse Monoclonal Antibody [Clone ID: OTI1A9]
TA504936S

USD 200.00

2 Days

NRIP3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NRIP3 Rabbit Polyclonal Antibody
TA350238

USD 380.00

In Stock

Rabbit Polyclonal Anti-NRIP3 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NRIP3
NRIP3 Rabbit Polyclonal Antibody
TA312668

USD 380.00

4 Weeks

Rabbit polyclonal anti-NRIP3 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NRIP3.
NRIP3 Rabbit Polyclonal Antibody
TA339739

USD 539.00

5 Days

Rabbit Polyclonal Anti-NRIP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NRIP3 antibody: synthetic peptide directed towards the middle region of human NRIP3. Synthetic peptide located within the following region: ALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEH
NRIP3 Rabbit Polyclonal Antibody
TA339740

USD 539.00

5 Days

Rabbit Polyclonal Anti-NRIP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NRIP3 antibody: synthetic peptide directed towards the middle region of human NRIP3. Synthetic peptide located within the following region: EKNLSLGLQTLRSLKCIINLDKHRLIMGKTDKEEIPFVETVSLNEDNTSE
NRIP3 Mouse Monoclonal Antibody [Clone ID: OTI1G6]
TA504921S

USD 200.00

2 Days

NRIP3 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated