Rabbit Polyclonal Anti-Nmral1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nmral1 antibody: synthetic peptide directed towards the n terminal of mouse Nmral1. Synthetic peptide located within the following region: GATGAQGGSVARALLEDGTFRIRVVTRNPEQRAAKELKQQGAEVVRGDQD |
Rabbit Polyclonal Anti-NMRAL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NMRAL1 antibody: synthetic peptide directed towards the middle region of human NMRAL1. Synthetic peptide located within the following region: TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA |
Germany
Japan
United Kingdom
China