NMNAT1 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NMNAT1 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NMNAT1 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NMNAT1 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
NMNAT1 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
NMNAT1 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
NMNAT1 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NMNAT1 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
In Stock
NMNAT1 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7), Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
NMNAT1 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7), HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-NMNAT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NMNAT1 antibody: synthetic peptide directed towards the N terminal of human NMNAT1. Synthetic peptide located within the following region: PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL |
NMNAT1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NMNAT1 (NP_073624.2). |
Modifications | Unmodified |
NMNAT1 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |