Antibodies

Jump to Filters
View as table Download
NKAIN1 (C-term) Rabbit Polyclonal Antibody
AP52882PU-N

USD 580.00

2 Weeks

NKAIN1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 156-186aa) of human NKAIN1 / FAM77C
NKAIN1 Rabbit Polyclonal Antibody
TA338660

USD 539.00

5 Days

Rabbit Polyclonal Anti-NKAIN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NKAIN1 antibody: synthetic peptide directed towards the middle region of human NKAIN1. Synthetic peptide located within the following region: TPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYV