Germany
Japan
United Kingdom
China
Antibodies
View as table Download
MRPS18C Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MRPS18C. |
Rabbit Polyclonal Anti-MRPS18C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MRPS18C antibody is: synthetic peptide directed towards the C-terminal region of Human MRPS18C. Synthetic peptide located within the following region: FVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKD |
Rabbit Polyclonal Anti-MRPS18C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MRPS18C antibody is: synthetic peptide directed towards the N-terminal region of Human MRPS18C. Synthetic peptide located within the following region: GTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGKHVDYKNVQL |
Active filters
Target Symbol
- MRPS18C