Antibodies

Jump to Filters
View as table Download
MMP24 Rabbit Polyclonal Antibody
TA350712

USD 380.00

In Stock

Rabbit Polyclonal Anti-MMP24 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MMP24
MMP24 Rabbit Polyclonal Antibody
AP13178PU-N

USD 580.00

2 Weeks

MMP24 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the center region of human MMP24.
MMP24 Rabbit Polyclonal Antibody
TA350713

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-MMP24 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MMP24
MMP24 Rabbit Polyclonal Antibody
TA341854

USD 539.00

5 Days

Rabbit Polyclonal Anti-MMP24 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP24 antibody: synthetic peptide directed towards the middle region of human MMP24. Synthetic peptide located within the following region: GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW
MMP24 Rabbit Polyclonal Antibody
TA354584

USD 425.00

5 Days

Rabbit anti MMP-24/MT5-MMP Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated