USD 447.00
In Stock
MUT mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
MUT mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
MUT mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) MUT mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) MUT mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
5 Days
MUT mouse monoclonal antibody,clone 2C8, Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
5 Days
MUT mouse monoclonal antibody,clone 2C8, HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
5 Days
MUT mouse monoclonal antibody,clone 2A8, Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
5 Days
MUT mouse monoclonal antibody,clone 2A8, HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit polyclonal Anti-Mut Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Mut antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mut. Synthetic peptide located within the following region: LAKKQLKGKNPEDLIWHTPEGISIKPLYSRADTLDLPEELPGVKPFTRGP |
MUT Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human MUT |
USD 200.00
2 Days
MUT mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 200.00
In Stock
MUT mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |