MX1 mouse monoclonal antibody, clone OTI2G12 (formerly 2G12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MX1 mouse monoclonal antibody, clone OTI2G12 (formerly 2G12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MX1 mouse monoclonal antibody, clone OTI2G12 (formerly 2G12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
MX1 mouse monoclonal antibody, clone OTI2G12 (formerly 2G12), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MX1 mouse monoclonal antibody, clone OTI2G12 (formerly 2G12), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MX1 mouse monoclonal antibody,clone OTI2E7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MX1 mouse monoclonal antibody,clone OTI2E7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
MX1 mouse monoclonal antibody,clone OTI2E7, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
MX1 mouse monoclonal antibody,clone OTI2E7, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
MX1 mouse monoclonal antibody, clone OTI2G12 (formerly 2G12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 276 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal Anti-MX1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MX1 |
MX1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 408-437aa) of human MX1 |
Rabbit Polyclonal Anti-MX1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MX1 antibody: synthetic peptide directed towards the C terminal of human MX1. Synthetic peptide located within the following region: KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG |
MX1 mouse monoclonal antibody,clone OTI2E7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |