Germany
Japan
United Kingdom
China
Antibodies
View as table Download
MTTP Rabbit polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human MTTP (NP_000244.2). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-MTTP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MTTP Antibody: synthetic peptide directed towards the N terminal of human MTTP. Synthetic peptide located within the following region: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK |
Rabbit Polyclonal Anti-MTTP Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MTTP Antibody is: synthetic peptide directed towards the C-terminal region of MOUSE MTTP. Synthetic peptide located within the following region: QVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSD |
MTTP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human MTTP (NP_000244.2). |
| Modifications | Unmodified |
Mttp rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from C-term domain of mouse MTTP |
Active filters
Target Symbol
- MTTP