Antibodies

Jump to Filters
View as table Download
MPPE1 Rabbit Polyclonal Antibody
TA338635

USD 539.00

5 Days

Rabbit Polyclonal Anti-MPPE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MPPE1 antibody: synthetic peptide directed towards the N terminal of human MPPE1. Synthetic peptide located within the following region: WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAG
MPPE1 Rabbit Polyclonal Antibody
TA362441

USD 539.00

5 Days

MPPE1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human MPPE1